top of page

CircRNA

Gene

chr8|103885297|103886223|+|1|circRNA|RIMS2|ENST00000504942.6|4

RIMS2

Open Reading Frame (ORF)

LCPEIRIEDTTKGKKERNIHSMLLRIPQCLDLHQIMLIGDLNMNLSFMKTLII

Peptide

ERNIHSMLLR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page