top of page

CircRNA

Gene

chr8|103062954|103066447|+|4|circRNA|ATP6V1C1|NM_001695|9,10,11,12

ATP6V1C1

Open Reading Frame (ORF)

LPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDCSFRGPRQLPV

Peptide

EVLHELYKHLDSSAAAIIDCSFR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page