top of page

CircRNA

Gene

chr8|101599056|101632365|+|4|circRNA|GRHL2|ENST00000251808.7|8,9,10,11

GRHL2

Open Reading Frame (ORF)

LAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANLQRTGQPITRRALIRLETLKRLHIMLFPLPGT

Peptide

LHIMLFPLPGT

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page