top of page

CircRNA

Gene

chr8|101367622|101369738|+|2|circRNA|NACAP1|ENST00000419462.1|2,3

NACAP1

Open Reading Frame (ORF)

LKLMKNQSVKQNRGGVKRRHGRLGSNWVFNRLQELLESPSGNLRISSLSSQNQMSTRARFGYLHGFWGSQD

Peptide

LQELLESPSGNLR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page