top of page

CircRNA

Gene

chr7|99417595|99419390|+|1|ciRNA|BUD31|ENST00000403633.6|5

BUD31

Open Reading Frame (ORF)

LAGQVLGRTRPGGQDPSFWGALGQKGVTQVHSLLPSSPTRVYQPRGPPEVPKQ

Peptide

GVTQVHSLLPSSPTR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page