top of page

CircRNA

Gene

chr7|98976148|98978904|+|5|circRNA|TRRAP|ENST00000355540.7|52,53,54,55,56

TRRAP

CircRNA UID

circTRRAP(52,53,54,55,56)

Open Reading Frame (ORF)

MLQGIEPVGSPDGVRSVQRPHQPLPRPGVRLAGVQLDCHEGGAGADWSAAQRFRSAVPHFHDAGREDVGPAFPQIVEDPL

Peptide

LAGVQLDCHEGGAGADWSAAQRFR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page