top of page

CircRNA

Gene

chr7|98186876|98204186|+|5|circRNA|LMTK2|NM_014916|9,10,11,12,13

LMTK2

Open Reading Frame (ORF)

LAALGALLPVLHLSRQHCQLFPHTPDRLGHRAGRRIILKQMIKKFSLCDGLLQN

Peptide

LGHRAGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page