top of page

CircRNA

Gene

chr7|96184276|96193183|—|6|circRNA|SLC25A13|ENST00000265631.9|11,10,9,8,7,6

SLC25A13

Open Reading Frame (ORF)

MQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGNTTGARKASLCATGQC

Peptide

GNTTGAR

ORF Found in Long-Read

true

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page