top of page

CircRNA

Gene

chr7|92671425|92833690|—|4|circRNA|CDK6|ENST00000265734.8|5,4,3,2

CDK6

Open Reading Frame (ORF)

LWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKCNDSGLRRAWAEAM

Peptide

KCNDSGLR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page