top of page

CircRNA

Gene

chr7|87426749|87440402|—|4|circRNA|ABCB4|ENST00000359206.7|16,15,14,13

ABCB4

Open Reading Frame (ORF)

MMKRLPLEWPQMAGNLAYLGILLRKTLKIHKCVRRALMWKPMDLLTLMGRILGTLM

Peptide

LTLMGRILGTLM

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page