top of page

CircRNA

Gene

chr7|80758330|80789528|-|4|circRNA|SEMA3C|ENST00000265361.7|15,14,13,12

SEMA3C

Open Reading Frame (ORF)

MKGFPRYLCTAATSMVQPVLTAAWRGTLIAPGMAIPVPDSTQLGNVSRRSIYTQYANHQGVPR

Peptide

GTLIAPGMAIPVPDSTQLGNVSRR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page