top of page

CircRNA

Gene

chr7|77241690|77262307|+|6|circRNA|CCDC146|ENST00000285871.4|4,5,6,7,8,9

CCDC146

Open Reading Frame (ORF)

LDLNLRNSLIDKQNYHDELSRKQREKERDFRNLRKMELLLKVSWDALRQTQALHQRLLLEHTRVRGPTATECQTFH

Peptide

VRGPTATECQTFH

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page