top of page

CircRNA

Gene

chr7|75592529|75599183|—|1|ciRNA|HIP1|NM_001243198|2

HIP1

Open Reading Frame (ORF)

LGAGSVPCSGWVQAQSPAVTGRAHPLFSISFWMLLGRPTLREVSSWGLRSGPGCLAQLQEGATLHRPGPCSF

Peptide

LGAGSVPCSGWVQAQSPAVTGR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page