top of page

CircRNA

Gene

chr7|75592525|75599183|-|1|ciRNA|HIP1|NM_001243198|2

HIP1

Open Reading Frame (ORF)

LTTICREWVCLELGLGRSGSRIPYMGNLRCGEIEGAPEQGQVGLRKKWGVEVYRKGILNKDCCCQGKQKAG

Peptide

IPYMGNLRCGEIEGAPEQGQVGLR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page