top of page

CircRNA

Gene

chr7|74338447|74339004|+|1|circRNA|CLIP2|ENST00000361545.9|3

CLIP2

CircRNA UID

circCLIP2(3)

Open Reading Frame (ORF)

LHKQSSGPSSSPAAAAAPEKPGPKAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTRQPTAEGSGSDAHSVESLTAQNLSLHSGTATPPLTSRVIPLRESVLNSSVKTGNESGSNLSDSGSVKRGEKDLRLGDRVLAPHCTNSHLDPPPPRPQLLPPRSRAPRRRKWGMTSWGTLWWASGCG

Peptide

LGDRVLAPHCTNSHLDPPPPRPQLLPPR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

21

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page