top of page

CircRNA

Gene

chr7|74239937|74249220|-|4|circRNA|RFC2|NM_001278791|7,6,5,4

RFC2

Open Reading Frame (ORF)

LKSLLEISFPGPSRNRQDHKHSVLGPGPAGPSTQRCHVGTQCFK

Peptide

SLLEISFPGPSR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page