top of page

CircRNA

Gene

chr7|73692646|73693302|+|1|ciRNA|WBSCR22|ENST00000265758.6|7

WBSCR22

CircRNA UID

ciWBSCR22(7)

Open Reading Frame (ORF)

LGDSTGKLSWGSDKESYADWREKEETCTLVWPLMAHLMT

Peptide

ESYADWR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page