top of page

CircRNA

Gene

chr7|72999760|73003730|-|4|circRNA|STAG3L3|ENST00000436857.5|5,4,3,2

STAG3L3

CircRNA UID

circSTAG3L3(5,4,3,2)

Open Reading Frame (ORF)

LKGLYGNRDLTARLELFTGRFKTRRQENDLRTASIAV

Peptide

DLTARLELFTGR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page