top of page

CircRNA

Gene

chr7|72969591|72970119|+|2|rescued|ENST00000436857|ENST00000436857|337,127|0,401

ENST00000436857

CircRNA UID

circENST00000436857(L1L,S2L)

Open Reading Frame (ORF)

LKDVIREGAGDLVAPDASVLGTPWGGLSAGSMSSHSCDLCSSRAREGQGRWRRLERNDECLLVAPEWNAAVGRGLPGIKGPSEPHQSHSQEGQRGAPGRRLTPQGGQLGHGGKRVKPGSPGRGRRPRPGEGPDVGA

Peptide

NDECLLVAPEWNAAVGR

ORF Found in Long-Read

true

Peptide Length

17

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page