top of page

CircRNA

Gene

chr7|72830691|72831798|+|2|circRNA|SBDSP1|NR_001588|2,3

SBDSP1

Open Reading Frame (ORF)

LEQMFRDIAIIVADKCVTPETKRPYTVILIERAMKDIHYLVKTNRSTKQQGKRP

Peptide

LEQMFRDIAIIVADK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page