top of page

CircRNA

Gene

chr7|680555|711527|-|2|circRNA|PRKAR1B|NM_002735|3,2

PRKAR1B

Open Reading Frame (ORF)

LARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKEGSSHPRHGLPARLPLGGGREPEGL

Peptide

HGLPARLPLGGGR

ORF Found in Long-Read

true

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page