top of page

CircRNA

Gene

chr7|6735304|6737936|+|2|circRNA|PMS2CL|ENST00000486256.5|8,9

PMS2CL

CircRNA UID

circPMS2CL(8,9)

Open Reading Frame (ORF)

LEKKKGTCPFPDCERPFLFVTQQRTSLTAQRLQNQEGAL

Peptide

TSLTAQR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page