top of page

CircRNA

Gene

chr7|67305986|67309715|+|3|circRNA|STAG3L4|ENST00000416602.6|2,3,4

STAG3L4

CircRNA UID

circSTAG3L4(2,3,4)

Open Reading Frame (ORF)

MKLMTSLVRVALQLSLHEDINQRQYEAERNKGPGQRAPERLESLLEKHKESLVDEWLDSYKQDQDAGFLELVNFFI

Peptide

ESLVDEWLDSYKQDQDAGFLELVNFFI

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

20

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page