top of page

CircRNA

Gene

chr7|66998064|67018143|+|5|circRNA|TYW1|NM_018264|2,3,4,5,6

TYW1

Open Reading Frame (ORF)

LRPTSEHGRPSSSPSCRHFRKGRERSPVAATARKANVNLTNMAQRRGRKDLMSRMNCIIETPRSFCGYMGPLLTFNIIMDKQVLHLFGLCC

Peptide

SPVAATAR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page