top of page

CircRNA

Gene

chr7|6425987|6436533|-|3|circRNA|DAGLB|NM_001142936|5,4,3

DAGLB

Open Reading Frame (ORF)

LVGGDQLNCHFGSILHTTGLQYRDFIHVSFHDKERFVTLDRGSLCLSCFTSAWRCFFQRWSGPLWGLPGWQMVFSATGQL

Peptide

DFIHVSFHDKER

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page