top of page

CircRNA

Gene

chr7|6170534|6171314|-|3|circRNA|CYTH3|ENST00000350796.7|9,8,7

CYTH3

Open Reading Frame (ORF)

LYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGSSYGASGCPGRRRRLIA

Peptide

LGSSYGASGCPGRR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page