top of page

CircRNA

Gene

chr7|6111124|6115523|+|2|circRNA|USP42|ENST00000306177.9|2,3

USP42

Open Reading Frame (ORF)

MASLLHRKFFSHLRRFVLSGNKLIELELGSRIWAIPVLPMQHCSV

Peptide

FVLSGNK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page