top of page

CircRNA

Gene

chr7|5982823|5987620|—|2|circRNA|PMS2|NM_000535|12,11

PMS2

Open Reading Frame (ORF)

LRGSASQTRAVTAAASMRPAPQGTGARRNMWTLRRKRLKLTTLFQMWTAIQTRKIPDVNFEFCLSQLISQPQTQSVLKKKKFFPVLTFVKS

Peptide

AVTAAASMRPAPQGTGARR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page