top of page

CircRNA

Gene

chr7|5725323|5730817|-|3|circRNA|RNF216|NM_207111|8,7,6

RNF216

CircRNA UID

circRNF216(8,7,6)

Open Reading Frame (ORF)

LSDAIKKWQELSPETSGKRKKRKQMNQYSYIDFKFEQDFVIFFWKTQIIQREKTESL

Peptide

FEQDFVIFFWKTQIIQR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

10

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page