top of page

CircRNA

Gene

chr7|56068481|56073111|+|2|circRNA|SUMF2|ENST00000395436.6|2,3

SUMF2

CircRNA UID

circSUMF2(2,3)

Open Reading Frame (ORF)

MFGWSFVFEDFVSDELRNKATQPMKEMDRLLAWSNCRVGDS

Peptide

ATQPMKEMDR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page