top of page

CircRNA

Gene

chr7|55142285|55143488|+|2|circRNA|EGFR|ENST00000455089.5|2,3

EGFR

CircRNA UID

circEGFR(2,3)

Open Reading Frame (ORF)

LKIIFSASRGCSITVRWSLGIWKLPMCRGIMIFPS

Peptide

IIFSASR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116,PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page