top of page

CircRNA

Gene

chr7|5324213|5325248|—|2|circRNA|TNRC18|ENST00000399537.8|21,20

TNRC18

Open Reading Frame (ORF)

LMESMAAEEDFEPNQDSSFSEDEHLPRGGAVERPLTPEEERERGWARSWAAAAPSSCLAL

Peptide

GGAVERPLTPEEER

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page