top of page

CircRNA

Gene

chr7|5309131|5333049|—|10|circRNA|TNRC18|ENST00000399537.8|28,27,26,25,24,23,22,21,20,19

TNRC18

Open Reading Frame (ORF)

MKGKARKLFYKAIVRGKEMIRIGDCAVFLSAGRPNLPYIGRIQSMWESWGNNMVVRVKWFYHPEETSPGKQFHQGQAQSSSTPTQRARSRCASGRLRGCCGPRRGWGSRDPPWPHPRLAPAVPTPAAQTRPSWRWRRGARPGSCGAPRSLASRRGPRPATTTCGRGAAASASSCTTPRLLHLRPSAPRPPPRPAAAPRAAP

Peptide

GWGSRDPPWPHPR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page