top of page

CircRNA

Gene

chr7|50732271|50756056|—|2|circRNA|GRB10|ENST00000401949.5|4,3

GRB10

Open Reading Frame (ORF)

LQRSKCNLKKAEGTHGFSRLPRFLFAPSVLPALALTTMLSRKQQLQAQ

Peptide

AEGTHGFSRLPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page