top of page

CircRNA

Gene

chr7|50669721|50705323|—|4|circRNA|GRB10|ENST00000406641.5|5,4,3,2

GRB10

Open Reading Frame (ORF)

LWPWEPPCAHAGFFTSEPGRRKADILEEGVNATLPPREQTSSF

Peptide

ADILEEGVNATLPPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page