top of page

CircRNA

Gene

chr7|50669721|50703908|-|3|circRNA|GRB10|ENST00000398810.6|4,3,2

GRB10

CircRNA UID

circGRB10(4,3,2)

Open Reading Frame (ORF)

LWPWEPPCAHAGFFTSEPGRRKAGQGGADTSQSTRPGRTRTPRTV

Peptide

AGQGGADTSQSTRPGR

ORF Found in Long-Read

true

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page