top of page

CircRNA

Gene

chr7|47344754|47369621|—|4|circRNA|TNS3|ENST00000311160.13|20,19,18,17

TNS3

Open Reading Frame (ORF)

LASQVAPRQSRPPTAQTTVTTPCLSAVTPATLQPLPGRIRRKSAWPQEPGGA

Peptide

LASQVAPR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page