top of page

CircRNA

Gene

chr7|44645326|44666851|+|3|circRNA|OGDH|NM_001003941|3,4,5

OGDH

CircRNA UID

circOGDH(3,4,5)

Open Reading Frame (ORF)

MAWMSLTSTRSSTCPPPLSSGDRNQHFLCGRSSVGWSHGTFFFATRMPEPHRALPTRVPFP

Peptide

MPEPHRALPTR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page