top of page

CircRNA

Gene

chr7|42148225|42223295|-|2|circRNA|GLI3|ENST00000395925.7|3,2

GLI3

CircRNA UID

circGLI3(3,2)

Open Reading Frame (ORF)

MGPCHTWRSPLCRTAGRCLPWTPGMVTWSPTTGIFGRRELK

Peptide

CLPWTPGMVTWSPTTGIFGRR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page