top of page

CircRNA

Gene

chr7|42148225|42148468|—|1|circRNA|GLI3|ENST00000395925.7|3

GLI3

Open Reading Frame (ORF)

MGPCHTWRSPLCRTAGRCLPWTPGMVTWSPTTRMKVLDRLITEREETQSLCSHRMSRGSAKSVRNLQHRVTRGPH

Peptide

CLPWTPGMVTWSPTTRMK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

TRUE

Peptide Exists in PepTransDB

false

bottom of page