top of page

CircRNA

Gene

chr7|34947702|34949796|—|1|ciRNA|DPY19L1|ENST00000310974.8|14

DPY19L1

Open Reading Frame (ORF)

LELSVFCRGTVYSSGLSVFIYCVPANGFDTQWLTKVYEF

Peptide

LELSVFCR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page