top of page

CircRNA

Gene

chr7|32543140|32559464|+|9|circRNA|AVL9|NM_015060|2,3,4,5,6,7,8,9,10

AVL9

CircRNA UID

circAVL9(2,3,4,5,6,7,8,9,10)

Open Reading Frame (ORF)

LNMVSVTVLSIDPGKVCLKMVGFRKVTHVQMILFLHPLLMFHIPTWELSGKSWQETMEKMLP

Peptide

LNMVSVTVLSIDPGK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page