top of page

CircRNA

Gene

chr7|30455136|30457042|—|2|circRNA|NOD1|NM_006092|5,4

NOD1

Open Reading Frame (ORF)

MPTWTSGLGCWRSASPLPCSLRAKSWSTLTQGLRRVAGALEGAA

Peptide

MPTWTSGLGCWR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page