top of page

CircRNA

Gene

chr7|27629370|27649633|-|3|circRNA|HIBADH|NM_152740|4,3,2

HIBADH

CircRNA UID

circHIBADH(4,3,2)

Open Reading Frame (ORF)

LILQFQKNWPKKLRKWEQFSWMPLFLVCVLGQWLQRLQLDSLDWATWGIQWQKIS

Peptide

WEQFSWMPLFLVCVLGQWLQR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page