top of page

CircRNA

Gene

chr7|24830767|24872069|-|13|circRNA|OSBPL3|NM_145320|14,13,12,11,10,9,8,7,6,5,4,3,2

OSBPL3

Open Reading Frame (ORF)

MYSGGQGLPVFFRTGQLGSGGRTEGGDELHPGATSSERIFAEKEEVALKRLA

Peptide

GQLGSGGRTEGGDELHPGATSSER

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page