top of page

CircRNA

Gene

chr7|23317638|23351586|-|7|circRNA|IGF2BP3|NM_006547|12,11,10,9,8,7,6

IGF2BP3

CircRNA UID

circIGF2BP3(12,11,10,9,8,7,6)

Open Reading Frame (ORF)

LMKWPPSKTPCSSPEVAGGLGRGAPQGRGLQDPYPSRNHVICLCACWFPPNLLEPS

Peptide

TPCSSPEVAGGLGR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page