top of page

CircRNA

Gene

chr7|1936686|2014642|-|5|circRNA|MAD1L1|NM_001013836|17,16,15,14,13

MAD1L1

Open Reading Frame (ORF)

LHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAGAGRYAGHPGVLRQRADPGRVLTPADAAHAGG

Peptide

EVAGAGRYAGHPGVLR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page