top of page

CircRNA

Gene

chr7|158739022|158741896|—|2|circRNA|ESYT2|ENST00000251527.9|18,17

ESYT2

Open Reading Frame (ORF)

MPAGAPSRKARKASRPPTLSSSQTSLCVQRGEENIHQISYVWVSRPWWQQHSSIHTSHWGQ

Peptide

MPAGAPSR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page