top of page

CircRNA

Gene

chr7|157595237|157682937|—|5|circRNA|PTPRN2|NM_001308268|17,16,15,14,13

PTPRN2

Open Reading Frame (ORF)

LAEKQTQVPASSGGARRLHQVHRAHPGLPRLHPGRPPGLWPHLLPPP

Peptide

LAEKQTQVPASSGGAR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page