top of page

CircRNA

Gene

chr7|152273704|152315338|-|4|circRNA|KMT2C|ENST00000262189.10|7,6,5,4

KMT2C

CircRNA UID

circKMT2C(7,6,5,4)

Open Reading Frame (ORF)

MYHYPCAAGAGTFQDFSHIFLLCPEHIDQAPERLNSSALFVTVGKKVP

Peptide

LNSSALFVTVGKK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page